PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023084-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 332aa    MW: 37109.4 Da    PI: 4.846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023084-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-143481148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  WALNUT_00023084-RA 34 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 81
                        678*******************************************97 PP

2Myb_DNA-binding49.31.2e-1587130146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+ l+++++ +lG++ W+ Ia++++ gRt++++k++w++
  WALNUT_00023084-RA  87 RGAFSPQEEALIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 130
                         89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-232684IPR009057Homeodomain-like
PROSITE profilePS5129415.4012981IPR017930Myb domain
SuperFamilySSF466892.62E-2733128IPR009057Homeodomain-like
SMARTSM007171.3E-93383IPR001005SANT/Myb domain
PfamPF002493.1E-133481IPR001005SANT/Myb domain
CDDcd001673.06E-83781No hitNo description
PROSITE profilePS5129425.19182136IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2585136IPR009057Homeodomain-like
SMARTSM007171.7E-1586134IPR001005SANT/Myb domain
PfamPF002499.6E-1587130IPR001005SANT/Myb domain
CDDcd001675.39E-1189132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MRKPEPSSCS SSSSSSAGKD IMNVQNSNNK LLRKGLWSPE EDDKLMNYML NNGQGCWSDV  60
ARNAGLQRCG KSCRLRWINY LRPDLKRGAF SPQEEALIIH LHSLLGNRWS QIAARLPGRT  120
DNEIKNFWNS TVKKRLRNLQ SGSPSPNTSD YSSSPKDQVM GGLISMQEQA GIMPMYMDSS  180
SSSSSMQAMA LNQMVDPLHM LQHDLNMSNN IASGHFNAPQ YMAQIDLGGD DLPGGNGAQL  240
GDVDIGFDGE MFVPPLESVG IEEQVETENT YNRAMNNNTF HNTNNNNINR AENLARVGNC  300
WEVEELRMGE WDLEEFMKDV PSFPLVDFQF SN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27321365108B-MYB
1h8a_C1e-263213625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7112844e-95KP711284.1 Betula platyphylla MYB transcription factor 46 (MYB46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571138.11e-131PREDICTED: transcription factor MYB46
TrEMBLD7SL501e-125D7SL50_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g02110.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.19e-68myb domain protein 46